PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000114.1_g00031.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family NAC
Protein Properties Length: 251aa    MW: 28362 Da    PI: 6.5339
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000114.1_g00031.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM126.71.8e-3941361128
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk.....kvkaeekewyfFskrdkkyatgkrknratksg 81 
                              lp GfrF Pt+eelv++yL++k++g++ +++ vi+ v+iy + Pw+Lp+       +++ ++w++F++  ++ a+g ++nr t++g
  Itr_sc000114.1_g00031.1   4 LPTGFRFYPTEEELVSFYLRNKLRGERPDIDLVIPVVNIYLHRPWELPQlagvvGGHGDYDQWFYFVPGPENIARGGKPNRLTTEG 89 
                              699***************************888***************6566432222445************************* PP

                      NAM  82 yWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                              yWkatg+   v+s +++++g k+t+vfy+gra++g+kt+W ++ey++
  Itr_sc000114.1_g00031.1  90 YWKATGSPGLVFSLNNRVIGEKRTMVFYTGRAQNGTKTEWKINEYKA 136
                              *********************************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.09E-443164IPR003441NAC domain
PROSITE profilePS5100544.6234164IPR003441NAC domain
PfamPF023654.0E-205135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 251 aa     Download sequence    Send to blast
MEDLPTGFRF YPTEEELVSF YLRNKLRGER PDIDLVIPVV NIYLHRPWEL PQLAGVVGGH  60
GDYDQWFYFV PGPENIARGG KPNRLTTEGY WKATGSPGLV FSLNNRVIGE KRTMVFYTGR  120
AQNGTKTEWK INEYKAVRGD ASASTPLSNL ELCQEFSLCR LYKKSKCDRA FDRRPLDLTA  180
TRRRIAQPPP QDNVQTTPIT VQEPSATEST GAGKISPPGA AVIPSNNATA TPLYWDNFEP  240
IWDWEDCFSL L
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A7e-28316514169Stress-induced transcription factor NAC1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009620854.11e-79PREDICTED: NAC domain-containing protein 90-like
TrEMBLA0A068UQS75e-82A0A068UQS7_COFCA; Uncharacterized protein
STRINGSolyc09g010160.1.12e-75(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24942357
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G22380.14e-66NAC domain containing protein 90